DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and dlg5a

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	XP_005156738.1	Gene:	dlg5a / 569065	ZFINID:	ZDB-GENE-030131-3149	Length:	1961	Species:	Danio rerio

Alignment Length:	87	Identity:	22/87 - (25%)
Similarity:	41/87 - (47%)	Gaps:	16/87 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 TYTLETDCRIMSF---YDAM----WGMEVTGGI-DQFEP----LTIVNVSPTGLAKRGGMRVGDE 78
            |.:||.:..::.|   .|.|    .|.::..|: |.:.|    :.:..|....:|. |.:||.|.
Zfish   687 TDSLEWETEVVEFEKDRDDMDLKAMGFDIAEGVNDPYLPGDCGIFVSRVDKGSIAD-GRLRVNDW 750

  Fly    79 ITQINDVPALEMTFNEALQMFR 100
            :.:||||   ::|..:..|:.:
Zfish   751 LLKINDV---DLTNKDRKQVIK 769

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	20/83 (24%)
dlg5a	XP_005156738.1	CARD	9..88	CDD:260018
		Takusan	128..211	CDD:282652
		Taxilin	295..627	CDD:286771
		RILP-like	338..460	CDD:304877
		SH3BP5	444..648	CDD:283045
		PDZ_signaling	696..783	CDD:238492	19/78 (24%)
		PDZ_signaling	793..866	CDD:238492
		PDZ	1381..1463	CDD:214570
		dbPDZ_assoc	1461..1541	CDD:293216
		PDZ	1541..1623	CDD:214570
		SH3_DLG5	1639..1701	CDD:212794
		Guanylate_kin	1780..1949	CDD:279019
		NK	1794..1950	CDD:302627
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900