Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009296312.1 | Gene: | ush1c / 564412 | ZFINID: | ZDB-GENE-060312-41 | Length: | 586 | Species: | Danio rerio |
Alignment Length: | 213 | Identity: | 45/213 - (21%) |
---|---|---|---|
Similarity: | 78/213 - (36%) | Gaps: | 82/213 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 GMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRV 108
Fly 109 YV---RGDD-----------DAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESN 159
Fly 160 CFMVPSKMEEKIRARR----------------------AATSAVHKKDE---------------- 186
Fly 187 ---LAPHTRSLTPTPRPK 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 19/69 (28%) |
ush1c | XP_009296312.1 | harmonin_N | 2..80 | CDD:259819 | |
PDZ_signaling | 85..165 | CDD:238492 | |||
PDZ_signaling | 212..292 | CDD:238492 | 18/66 (27%) | ||
RILP-like | 317..>379 | CDD:304877 | 13/73 (18%) | ||
PDZ_signaling | 447..534 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |