DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and ush1c

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_009296312.1 Gene:ush1c / 564412 ZFINID:ZDB-GENE-060312-41 Length:586 Species:Danio rerio


Alignment Length:213 Identity:45/213 - (21%)
Similarity:78/213 - (36%) Gaps:82/213 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRV 108
            |:.::.|..:...:.:.||.|..|:...|::|||:|.::|.|....::..||:::. |:||.:.:
Zfish   226 GISISSGPTKKPGIYVSNVKPGSLSAEVGLQVGDQIVEVNGVEFTNLSHQEAVRVL-KSSRSLTI 289

  Fly   109 YV---RGDD-----------DAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESN 159
            .|   .|.:           :|..|.|             |::..          .:|.|..|:|
Zfish   290 TVLTGAGSELFMTDEERLAVEARHELD-------------RQELM----------HQKKVALETN 331

  Fly   160 CFMVPSKMEEKIRARR----------------------AATSAVHKKDE---------------- 186
              .:..:.:||.|.|:                      ||....||:.|                
Zfish   332 --KIVKEQQEKERQRKMEISQKAAEEEERYRKEMERIEAAEKKHHKEWEDDWGSKEKKKSVSPAA 394

  Fly   187 ---LAPHTRSLTPTPRPK 201
               ..|.|| |.|:|:||
Zfish   395 SPSPPPPTR-LAPSPKPK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 19/69 (28%)
ush1cXP_009296312.1 harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492
PDZ_signaling 212..292 CDD:238492 18/66 (27%)
RILP-like 317..>379 CDD:304877 13/73 (18%)
PDZ_signaling 447..534 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.