DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and PARD3

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_062565.2 Gene:PARD3 / 56288 HGNCID:16051 Length:1356 Species:Homo sapiens


Alignment Length:80 Identity:20/80 - (25%)
Similarity:36/80 - (45%) Gaps:14/80 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLTIVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFR--KNSRYVRVYVRGDDDAP 117
            |:.:.|:.|.|.| :.|.::.||.:.::|.|..:..:..|.:.:.|  |....|.:.|...:|| 
Human   487 PIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDA- 550

  Fly   118 GEEDWTCDCWFKPRK 132
                      |.||:
Human   551 ----------FHPRE 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 14/57 (25%)
PARD3NP_062565.2 DUF3534 1..146 CDD:288873
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..262
PDZ_signaling 272..347 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..448
PDZ_signaling 465..544 CDD:238492 14/56 (25%)
PDZ_signaling 588..681 CDD:238492
Interaction with PRKCI and PRKCZ. /evidence=ECO:0000250|UniProtKB:Q9Z340 712..936
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 865..886
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 932..1025
Interaction with FRMD4A. /evidence=ECO:0000250|UniProtKB:Q99NH2 935..1356
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1129..1356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.