DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and grip2b

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_021325304.1 Gene:grip2b / 562290 ZFINID:ZDB-GENE-070705-172 Length:1086 Species:Danio rerio


Alignment Length:229 Identity:58/229 - (25%)
Similarity:92/229 - (40%) Gaps:55/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
            |:::.| |.|..|.......:.||:|     :..|....|:.::|..:.|:|:.|..::..|||:
Zfish   639 KLKIRK-DEDNSDEQESSGSIIYTVE-----LKRYGGPLGITISGTEEPFDPIIISGLTKRGLAE 697

  Fly    70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAPGE-------------- 119
            | |.:.|||.|..||.|.......:||:.:.:.....|.:.::...|:|.|              
Zfish   698 RTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQADSPDEKNKENDLENDLSDN 762

  Fly   120 EDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESNCFMVPSKME----EKIRARRAATSA 180
            ||               :.|..|.|...:|    :| .:....|.|.||    ..|.|..::..|
Zfish   763 ED---------------EMTDSQKTNKLSD----IY-STTIPSVDSAMESWDGSGIDAGYSSQGA 807

  Fly   181 -VHKKDELA--PH------TRSLTPTP-RPKNQP 204
             :|:...:|  ||      .|:.||.| |.||.|
Zfish   808 FIHQAAGIALHPHEWRNTKQRNSTPPPTRRKNYP 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 22/81 (27%)
grip2bXP_021325304.1 PDZ_signaling 45..127 CDD:238492
PDZ 144..232 CDD:214570
PDZ_signaling 245..328 CDD:238492
PDZ_signaling 462..548 CDD:238492
PDZ_signaling 561..643 CDD:238492 1/3 (33%)
PDZ_signaling 659..740 CDD:238492 24/85 (28%)
Peptidase_S41 672..>841 CDD:321971 48/188 (26%)
PDZ_signaling 970..1050 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.