DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and lnx1

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 / 561226 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio


Alignment Length:191 Identity:44/191 - (23%)
Similarity:69/191 - (36%) Gaps:54/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFE---PLTIVNVSPTG-LAKRGGMRVGDEITQ 81
            ||..:|...|.       :|:: ||.|.||:....   |:.:.||.|.| :.:.|.:|.||.:..
Zfish   535 YEKTVTLLKEP-------HDSL-GMTVAGGMSSRGWDLPVYVTNVDPNGVVGQEGSIRKGDILLN 591

  Fly    82 INDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAPGEEDWTC------DCWFKPRKPW------ 134
            :|.|....:|.:||:...:..|..|.:.|. :...|.|....|      .|...|..|.      
Zfish   592 VNGVDLTGVTRSEAVANLKNTSSPVVLQVL-EMRPPNESSLDCMPPLHSPCALSPSSPGDVKLPP 655

  Fly   135 -RRDFTPIQWTFPWNDRRKPVY-----------------------KESNC---FMVPSKME 168
             ..|:.|: |. .|....:.:|                       :|.||   |.:.|.:|
Zfish   656 PNDDYAPL-WV-SWLQLPRHLYCCKDIVLRRSTSGSLGFSIVGGQEELNCNQSFFIRSIVE 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 23/84 (27%)
lnx1XP_005160562.1 RING 57..93 CDD:214546
PDZ_signaling 297..381 CDD:238492
PDZ_signaling 411..491 CDD:238492
PDZ_signaling 536..621 CDD:238492 25/92 (27%)
DegQ <548..621 CDD:223343 21/73 (29%)
PDZ_signaling 678..762 CDD:238492 6/37 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.