DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and a

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_001014543.1	Gene:	a / 43852	FlyBaseID:	FBgn0000008	Length:	1329	Species:	Drosophila melanogaster

Alignment Length:	67	Identity:	22/67 - (32%)
Similarity:	32/67 - (47%)	Gaps:	9/67 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 GMEVTGGIDQFEP-----LTIVNVSPTG-LAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKN 102
            |..:.||.|  .|     :.:..|.|:| .|..|.::.||||.:||......|:..|.:.:| ||
  Fly  1245 GFSIVGGRD--SPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLF-KN 1306

  Fly   103 SR 104
            .|
  Fly  1307 VR 1308

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	22/67 (33%)
a	NP_001014543.1	PDZ_signaling	775..865	CDD:238492
a	NP_001014543.1	PDZ_signaling	1230..1317	CDD:238492	22/67 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900