Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163693.1 | Gene: | CG34375 / 42715 | FlyBaseID: | FBgn0085404 | Length: | 568 | Species: | Drosophila melanogaster |
Alignment Length: | 268 | Identity: | 47/268 - (17%) |
---|---|---|---|
Similarity: | 87/268 - (32%) | Gaps: | 102/268 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 CRIMSFYDAMWGMEVTGGIDQFEPLTIVN-VSPTGLAKRGGMRVGDEITQINDVPALEMTFNE-- 94
Fly 95 --------------ALQMFRKNSRYVRVYVRGDDDAPGEED------------------------ 121
Fly 122 ---------------WTC--------DCWFK---------PRKPWRRD------FTPIQWTFPWN 148
Fly 149 DRRKPVYKESNCFMVPSKMEEKIRARRAATSAVHKKDELAPHTRSLTPTPRPKNQPGPNL---LE 210
Fly 211 TVLRPRGP 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 19/94 (20%) |
CG34375 | NP_001163693.1 | PDZ | 13..86 | CDD:238080 | 15/74 (20%) |
RING | 129..168 | CDD:238093 | 3/38 (8%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |