DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and CG34375

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:268 Identity:47/268 - (17%)
Similarity:87/268 - (32%) Gaps:102/268 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CRIMSFYDAMWGMEVTGGIDQFEPLTIVN-VSPTGLAKRGGMRVGDEITQINDVPALEMTFNE-- 94
            |.|.:..:...|:.::..  .::|...|: |.....|:|||:|:||.:.::|....|.:..:|  
  Fly     5 CTIYACANGTLGLNLSRA--PWDPYPWVSGVQAKSSAERGGVRLGDTLLELNGADVLGLKISELA 67

  Fly    95 --------------ALQMFRKNSRYVRVYVRGDDDAPGEED------------------------ 121
                          .|.|:|:.:.     :..::| |.|..                        
  Fly    68 NRLQDHWQSGAEVVTLMMWRQQAN-----IDPNED-PAEASHAVQHGINQQSLQKFATCLQHISQ 126

  Fly   122 ---------------WTC--------DCWFK---------PRKPWRRD------FTPIQWTFPWN 148
                           |.|        :|..:         |..|..|.      ||.:..:||.:
  Fly   127 LLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLFTLLAESFPCD 191

  Fly   149 DRRKPVYKESNCFMVPSKMEEKIRARRAATSAVHKKDELAPHTRSLTPTPRPKNQPGPNL---LE 210
            ..:...       :..|:...|:.:....|:..|.:.::|     |..|...|::.|..:   ||
  Fly   192 GGKTNK-------VAASQGHGKLSSVNKCTNEYHNQPKMA-----LAKTSSGKSKCGKQISRQLE 244

  Fly   211 TVLRPRGP 218
            |||..:.|
  Fly   245 TVLVDQSP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 19/94 (20%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 15/74 (20%)
RING 129..168 CDD:238093 3/38 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.