DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Syn1

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster


Alignment Length:221 Identity:49/221 - (22%)
Similarity:82/221 - (37%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLA--KRGGMRVG 76
            |..|:||.:.:....:::|...:       |:.:.||.:...|:.|..:. .|:|  :..|:.||
  Fly   153 DVPDHVANQKRHVRIIKSDNNGL-------GISIKGGRENRMPILISKIF-RGMAADQAKGLYVG 209

  Fly    77 DEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAP---------GEEDWTCD-CWFKPR 131
            |.|..:|.....:.|.:||::..:::.|.|.:.|:...:..         .|..|... .:..|.
  Fly   210 DAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPL 274

  Fly   132 KPWRRDFTPIQWTFPWNDRR-------------KPVYKESNCFMVPSKMEEKIRARRAATS---- 179
            .|......|...|.|..|.|             |.:..|:.||.:.|.........|||.|    
  Fly   275 GPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEAL 339

  Fly   180 ----AVHK------KDELAPHTRSLT 195
                |:|.      :..||...|:||
  Fly   340 VWFNALHSAMGTSTQRALAEANRALT 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 19/82 (23%)
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 19/88 (22%)
PHsplit_syntrophin <293..351 CDD:269960 12/57 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.