DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Zasp67

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster


Alignment Length:196 Identity:47/196 - (23%)
Similarity:67/196 - (34%) Gaps:72/196 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEAL 96
            |.::..|.:..||..:.||.|...|||:|.|:...:|...|:||.|.|.:|||..|..:|.:||.
  Fly     4 DIKMCRFDNVPWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAH 68

  Fly    97 QMFRKNSR--YVRVYVRGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESN 159
            ::...:..  |..||...::||       .:|..|               ||.::          
  Fly    69 RLIMGSGSVFYFGVYRENEEDA-------YECLKK---------------FPTSE---------- 101

  Fly   160 CFMVPSKMEEKIRARRAATSAVHKKDELAPHTRSLTPTPRPKNQPGP-----NLLETVLRPRGPP 219
                                            .|||.:|.|...|.|     .|.||. ..|.|.
  Fly   102 --------------------------------GSLTKSPMPTISPSPTPSLSQLTETT-NARTPE 133

  Fly   220 P 220
            |
  Fly   134 P 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 28/80 (35%)
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 25/70 (36%)
DUF4749 653..>699 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.