DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and Fife

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_001261340.1	Gene:	Fife / 38337	FlyBaseID:	FBgn0264606	Length:	1314	Species:	Drosophila melanogaster

Alignment Length:	138	Identity:	33/138 - (23%)
Similarity:	48/138 - (34%)	Gaps:	40/138 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    43 WGMEVTG---GIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSR 104
            :||.|.|   |.|......||...|.|.|::.|::.||:|.:.|.:..::.:|.|...:..:...
  Fly   509 FGMRVVGGKTGADGRLFAYIVWTVPGGAAEKNGLQQGDKILEWNGMSLIDRSFEEVCSIMDRTGD 573

  Fly   105 YVRVYV---------------------------RGDDDAP------GEEDWTCDCWFKPRKPWRR 136
            .|.:.|                           |...|.|      .|.:.|.|  ..|..|.||
  Fly   574 VVELLVEHATDFRMCDLFDENLPPGNAGGQSGPRRSGDGPVGLGLIAEPETTTD--KSPASPTRR 636

  Fly   137 DF--TPIQ 142
            ..  ||.|
  Fly   637 KLPKTPEQ 644

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	20/97 (21%)
Fife	NP_001261340.1	FYVE_BSN_PCLO	130..187	CDD:277290
		PDZ_signaling	491..580	CDD:238492	19/70 (27%)
		DegQ	<526..577	CDD:223343	13/50 (26%)
		C2A_RIM1alpha	651..779	CDD:175997
		C2	1163..1304	CDD:301316
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900