DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and CG42319

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster


Alignment Length:110 Identity:34/110 - (30%)
Similarity:54/110 - (49%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVG 76
            ||||           |..:.|.|        ||..:|||.:...|||:..|:|.|||.:.|:|:|
  Fly    39 DSDA-----------YATKDDSR--------WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLG 84

  Fly    77 DEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRG--DDDAPGE 119
            |.|.:||:..|.::|.::|.:......:.:...:|.  :||..|:
  Fly    85 DIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 25/80 (31%)
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.