DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and CG43707

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001260005.1 Gene:CG43707 / 33601 FlyBaseID:FBgn0263846 Length:2021 Species:Drosophila melanogaster


Alignment Length:189 Identity:38/189 - (20%)
Similarity:69/189 - (36%) Gaps:31/189 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRV 75
            |......|.|:.:..|..:::|       ...:|..:.|.    :|:.:..:.|...|:..|:.|
  Fly  1686 YVISKLSNGAHGVDKTVVVKSD-------SGEFGFRIHGS----KPVVVAAIEPETPAESSGLEV 1739

  Fly    76 GDEITQINDVPALEMTFNEALQMFRKN--------SRYVRVYVRGDDDAPGEEDWTCDCWFKPRK 132
            ||.|..:|.|..|:....|.:::....        :|.:.|.:....:.|.:..::...|   |:
  Fly  1740 GDIIISVNGVQVLDKHHTEVVKIAHDGCEKLELQVARTIGVLMHEQLEPPSQPIFSGYLW---RQ 1801

  Fly   133 PWRRDFTP--IQWTFPWNDRRKPVYKESNCFMVPSKMEEKIRARRAATSAVHKKDELAP 189
            ..:....|  .:|...|...|     ..|| :...|.|:..:...|...|.|..| |.|
  Fly  1802 SGQAKGAPNSKKWVRRWFSLR-----PDNC-LYYYKTEDDSQPVGAMIMAKHTVD-LCP 1853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 17/88 (19%)
CG43707NP_001260005.1 PHA03369 <987..1394 CDD:223061
PDZ_signaling 1702..1775 CDD:238492 15/83 (18%)
PH 1792..1894 CDD:278594 16/72 (22%)
PH-like 1792..1893 CDD:302622 16/72 (22%)
PH-like 1911..2011 CDD:302622
PH 1921..2014 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.