DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and PsGEF

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_996333.4 Gene:PsGEF / 31224 FlyBaseID:FBgn0264598 Length:2777 Species:Drosophila melanogaster


Alignment Length:179 Identity:35/179 - (19%)
Similarity:59/179 - (32%) Gaps:61/179 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DAMWGMEVTGGIDQFEPLTIVN-----VSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMF 99
            :.:||...:||.:..:.|.::|     .|||           ...|.:||....|:..:|.|...
  Fly  1967 EEVWGTPTSGGDNDDQDLQLINSENTHSSPT-----------KSSTSLNDDDDTELMMDELLMAP 2020

  Fly   100 RKNSRYVRVYVRGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESNCFMVP 164
            ...:..:|..:                   ||. :||             |.:|:::|..     
  Fly  2021 PMTASTIRGLL-------------------PRF-YRR-------------RLEPLFEEET----- 2047

  Fly   165 SKMEEK-------IRARRAATSAVHKKDELAPHTRSLTPTPRPKNQPGP 206
            ...|||       |:...|.|:..:.:|.....:.|.:..|.|...|.|
  Fly  2048 ESDEEKTQQDSDDIKKGEATTNGHYLEDSAGSSSDSESVPPAPPLVPRP 2096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 16/75 (21%)
PsGEFNP_996333.4 DUF4799 <102..209 CDD:292674
C2 286..>381 CDD:278593
PDZ_signaling 644..716 CDD:238492
RhoGEF 831..1000 CDD:295373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.