DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Pard3b

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001178737.1 Gene:Pard3b / 301455 RGDID:1584992 Length:1203 Species:Rattus norvegicus


Alignment Length:77 Identity:21/77 - (27%)
Similarity:34/77 - (44%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLTIVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFR--KNSRYVRVYVRGDDDA- 116
            |:.:.|:.|.|.| |.|.::.||.|.::|.......|..|.:.|.|  |....|.:.:...:.: 
  Rat   409 PIFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSF 473

  Fly   117 -PGEEDWTCDCW 127
             |.|.....||:
  Rat   474 LPRELKGEPDCY 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 17/57 (30%)
Pard3bNP_001178737.1 DUF3534 1..143 CDD:288873
PDZ_signaling 201..288 CDD:238492
PDZ 380..469 CDD:214570 17/59 (29%)
PDZ_signaling 501..589 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.