DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Pdzd7

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001099832.2 Gene:Pdzd7 / 293996 RGDID:1309882 Length:1031 Species:Rattus norvegicus


Alignment Length:178 Identity:42/178 - (23%)
Similarity:63/178 - (35%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFDSKIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPT 65
            :.:|.|.....:||....|..|...:..|              |..|.||.:....:.:..|...
  Rat    69 LINSPIEANSDESDIIHAVCVEKSPSGRL--------------GFSVRGGSEHGLGIFVSKVEEG 119

  Fly    66 GLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAPGEEDWTCDCWFKP 130
            ..|:|.|:.|||:||::|.:.....|...|:::...:|| :.:.||.....||.:       |..
  Rat   120 SSAERAGLCVGDKITEVNGLSLESTTMGSAVRLLTSSSR-LHMMVRRMGRVPGIK-------FSK 176

  Fly   131 RKPWRRDFTPIQWTFPWND---RRKPVYKESNCFMVPSKMEEKIRARR 175
            .|.            .|.|   ||..|.|   |...||....:...||
  Rat   177 EKT------------TWVDVVNRRLVVEK---CSSTPSDSSSEDGVRR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 18/80 (23%)
Pdzd7NP_001099832.2 PDZ_signaling 84..164 CDD:238492 21/94 (22%)
PDZ_signaling 209..289 CDD:238492 1/1 (100%)
HN_PDZD7_like 555..632 CDD:259824
PDZ_signaling 866..954 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.