Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016874587.1 | Gene: | GRIP1 / 23426 | HGNCID: | 18708 | Length: | 1188 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 50/236 - (21%) |
---|---|---|---|
Similarity: | 90/236 - (38%) | Gaps: | 58/236 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
Fly 70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAPGEEDWTCDCWFKPRKP 133
Fly 134 WRRDFTPIQWTFPWNDRRK---PVYKESNCFMVPSKMEEKIRAR-RAATSAVHKKDELA------ 188
Fly 189 --------------------PHTR-SLTPTPRPKNQPGPNL 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 20/81 (25%) |
GRIP1 | XP_016874587.1 | PDZ_signaling | 128..208 | CDD:238492 | |
PDZ_signaling | 227..310 | CDD:238492 | |||
PDZ_signaling | 325..408 | CDD:238492 | |||
PDZ_signaling | 545..633 | CDD:238492 | |||
PDZ_signaling | 646..730 | CDD:238492 | 1/3 (33%) | ||
PDZ_signaling | 746..827 | CDD:238492 | 22/85 (26%) | ||
PDZ_signaling | 1062..1142 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |