DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and F20D6.1

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_505110.2 Gene:F20D6.1 / 184722 WormBaseID:WBGene00017633 Length:180 Species:Caenorhabditis elegans


Alignment Length:201 Identity:42/201 - (20%)
Similarity:62/201 - (30%) Gaps:83/201 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GIDQFEPLTIVNVSPT----GLAKRGGMRVGDEITQINDVPALEM-TFNEALQM-FRKNSRYVRV 108
            ||:......:|.|..|    |...|..:.:||.|.:|:|...|:: |...||:. |.||. .|.:
 Worm    16 GINVKSYQNVVYVESTDNTWGSTTRRFLYLGDAILRIDDTEILDLPTTQNALRTGFSKNG-VVTI 79

  Fly   109 YVRGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESNCF------------ 161
            .|                                        .:.|::||..|            
 Worm    80 IV----------------------------------------ERAVHQESYAFVRSVMGFSKVLD 104

  Fly   162 -MVPSKMEEKIRARRAATSAVHKKDELAPHTR---------------SLTPTPRPKN----QPGP 206
             |:|..:.:...||    .|.|.|...|..|.               |:|.|...|:    |..|
 Worm   105 PMLPQDVIQTCTAR----LAYHNKHGFAEPTPIFKGYTKDYSSAGRVSVTNTVEIKSIRTEQLNP 165

  Fly   207 NLLETV 212
            .:|:.|
 Worm   166 EILQNV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/66 (30%)
F20D6.1NP_505110.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.