powered by:
Protein Alignment CG15617 and txt-1
DIOPT Version :9
Sequence 1: | NP_611151.1 |
Gene: | CG15617 / 36871 |
FlyBaseID: | FBgn0034151 |
Length: | 222 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493661.1 |
Gene: | txt-1 / 183651 |
WormBaseID: | WBGene00016807 |
Length: | 152 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 26/68 - (38%) |
Gaps: | 16/68 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 FDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEIT 80
|:.:...|.||...:....|:|.: :.:.:..|....|. .|.::.||:|.
Worm 42 FERIKVTLMMTQGKKFGLGIVSVH---------------QRILVCKVENESLV-AGVLKYGDQII 90
Fly 81 QIN 83
:||
Worm 91 EIN 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.