powered by:
Protein Alignment CG15617 and mpz-4
DIOPT Version :9
Sequence 1: | NP_611151.1 |
Gene: | CG15617 / 36871 |
FlyBaseID: | FBgn0034151 |
Length: | 222 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500654.1 |
Gene: | mpz-4 / 177255 |
WormBaseID: | WBGene00019165 |
Length: | 402 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 30/70 - (42%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 IDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKN---SRYVRVYVRG 112
:.|.:...:||.:.........:.:|:.|..::|.|...:..|. |.||:. :.::|:.|..
Worm 220 VQQVDRKVVVNYTIPDSVSHCSLNIGEAIIAVDDKPINTLADNR--QRFREGFEANGWIRLLVEY 282
Fly 113 DDDAP 117
.:..|
Worm 283 PNTDP 287
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15617 | NP_611151.1 |
PDZ_signaling |
30..111 |
CDD:238492 |
12/62 (19%) |
mpz-4 | NP_500654.1 |
PDZ |
<81..130 |
CDD:381812 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.