DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and Mpdz

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_001292213.1	Gene:	Mpdz / 17475	MGIID:	1343489	Length:	2069	Species:	Mus musculus

Alignment Length:	84	Identity:	26/84 - (30%)
Similarity:	46/84 - (54%)	Gaps:	3/84 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 GMEVTGGIDQFEPLTIVN-VSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYV 106
            |:.:.||.|......|:: |...|.| |.|.:..||:|.::|.:...:.|.:||:.:.|:..:.|
Mouse  1639 GLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRV 1703

  Fly   107 RVYVRGDDDAPGEEDWTCD 125
            |:.:. .|:||.:|:..||
Mouse  1704 RLTLY-RDEAPYKEEDVCD 1721

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	20/68 (29%)
Mpdz	NP_001292213.1	L27_2	6..63	CDD:117611
		PDZ_signaling	140..222	CDD:238492
		PDZ_signaling	256..335	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	348..372
		PDZ	375..464	CDD:214570
		PDZ_signaling	553..622	CDD:238492
		PDZ_signaling	694..777	CDD:238492
		PDZ_signaling	994..1064	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1125..1144
		PDZ_signaling	1151..1242	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1278..1313
		PDZ	1349..1434	CDD:214570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1449..1473
		PDZ_signaling	1483..1563	CDD:238492
		MPDZ_u10	1564..1625	CDD:293272
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1571..1611
		PDZ	1626..1710	CDD:214570	20/71 (28%)
		PDZ_signaling	1722..1802	CDD:238492	26/84 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1809..1848
		PDZ_signaling	1859..1944	CDD:238492
		PDZ_signaling	1985..2068	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810