DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Grip2

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_612544.2 Gene:Grip2 / 171571 RGDID:621668 Length:1043 Species:Rattus norvegicus


Alignment Length:272 Identity:56/272 - (20%)
Similarity:88/272 - (32%) Gaps:94/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
            |:::.| |.|..|.......::||:|     :..|....|:.::|..:.|:|:.|..::..|||:
  Rat   636 KLKIRK-DEDNSDEQESSGAVSYTVE-----LKRYGGPLGITISGTEEPFDPIIISGLTKRGLAE 694

  Fly    70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAP--------------GE 119
            | |.:.|||.|..||.|.......:||:.:.:.....|.:.::...|.|              .:
  Rat   695 RTGAIHVGDRILAINSVSLKGRPLSEAIHLLQVAGETVTLKIKKQLDRPLLPRQSGSLSEASDVD 759

  Fly   120 ED-------WTCDCWFKPRKP--------WR--------------------RDFTPIQWTFPWND 149
            ||       ......|.|..|        |.                    |..||.:|      
  Rat   760 EDPPEALKGGLLTTHFSPAVPSVDSAVESWGSSATEGGFGGSGSYTPQVAVRSVTPQEW------ 818

  Fly   150 RRKPVYKESNCFMVPSKMEEKIRARRAATSAVHKKDELAPHTRSLTPTPR----PKNQPGPNLLE 210
                                  |:.|..:|    ...|.|...|.||.|.    |:.:.|.  .|
  Rat   819 ----------------------RSSRLKSS----PPPLEPRRTSYTPGPTDESFPEEEEGD--WE 855

  Fly   211 TVLRPRGPPPRD 222
            ..:.|...|.|:
  Rat   856 PPMSPAPGPARE 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 22/81 (27%)
Grip2NP_612544.2 PDZ_signaling 51..133 CDD:238492
PDZ_signaling 153..236 CDD:238492
PDZ_signaling 251..334 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..450
PDZ_signaling 456..544 CDD:238492
PDZ_signaling 557..640 CDD:238492 1/3 (33%)
PDZ_signaling 657..737 CDD:238492 24/84 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 745..769 2/23 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 786..863 18/110 (16%)
PDZ_signaling 941..1020 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.