Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612544.2 | Gene: | Grip2 / 171571 | RGDID: | 621668 | Length: | 1043 | Species: | Rattus norvegicus |
Alignment Length: | 272 | Identity: | 56/272 - (20%) |
---|---|---|---|
Similarity: | 88/272 - (32%) | Gaps: | 94/272 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
Fly 70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAP--------------GE 119
Fly 120 ED-------WTCDCWFKPRKP--------WR--------------------RDFTPIQWTFPWND 149
Fly 150 RRKPVYKESNCFMVPSKMEEKIRARRAATSAVHKKDELAPHTRSLTPTPR----PKNQPGPNLLE 210
Fly 211 TVLRPRGPPPRD 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 22/81 (27%) |
Grip2 | NP_612544.2 | PDZ_signaling | 51..133 | CDD:238492 | |
PDZ_signaling | 153..236 | CDD:238492 | |||
PDZ_signaling | 251..334 | CDD:238492 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 371..450 | ||||
PDZ_signaling | 456..544 | CDD:238492 | |||
PDZ_signaling | 557..640 | CDD:238492 | 1/3 (33%) | ||
PDZ_signaling | 657..737 | CDD:238492 | 24/84 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 745..769 | 2/23 (9%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 786..863 | 18/110 (16%) | |||
PDZ_signaling | 941..1020 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |