| Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001347016.1 | Gene: | Il16 / 16170 | MGIID: | 1270855 | Length: | 1424 | Species: | Mus musculus |
| Alignment Length: | 197 | Identity: | 44/197 - (22%) |
|---|---|---|---|
| Similarity: | 69/197 - (35%) | Gaps: | 38/197 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 VSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRK-NSRYVRVYVRGDDDAPGEEDWTC 124
Fly 125 DC---------WFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESNCFMVPSKMEEKIRARRAATSA 180
Fly 181 V-----------------HKKDELAPHTRSLTP---------TPRPKNQPGPNLLETVLRPRGPP 219
Fly 220 PR 221 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 17/50 (34%) |
| Il16 | NP_001347016.1 | PDZ_signaling | 316..391 | CDD:238492 | |
| PDZ_signaling | 454..536 | CDD:238492 | 17/49 (35%) | ||
| Atrophin-1 | <620..931 | CDD:331285 | 14/62 (23%) | ||
| PDZ_signaling | 1206..1283 | CDD:238492 | |||
| PDZ_signaling | 1328..1409 | CDD:238492 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||