DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and Patj

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_766284.2	Gene:	Patj / 12695	MGIID:	1277960	Length:	1834	Species:	Mus musculus

Alignment Length:	80	Identity:	23/80 - (28%)
Similarity:	39/80 - (48%)	Gaps:	2/80 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 GMEVTGGID-QFEPLTIVNVSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRKNSRYV 106
            |:.:.||.| ..:.:.|..|...|.|.|.| :..||:|.::|.|.....:..||:...|:..:.|
Mouse  1483 GLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKV 1547

  Fly   107 RVYVRGDDDAPGEED 121
            |:.|..|:....:|:
Mouse  1548 RLVVYRDEAQYRDEE 1562

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	20/68 (29%)
Patj	NP_766284.2	L27_2	8..65	CDD:312549
		PDZ_signaling	135..218	CDD:238492
		PDZ_signaling	248..325	CDD:238492
		PDZ_signaling	363..450	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	456..488
		PDZ_signaling	572..636	CDD:238492
		PDZ	685..774	CDD:214570
		PDZ_signaling	1072..1163	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1171..1219
		PDZ	1242..1327	CDD:214570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1340..1453
		MPDZ_u10	<1453..1468	CDD:374710
		PDZ	1469..1554	CDD:214570	21/70 (30%)
		PDZ_signaling	1566..1646	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1657..1676
		PDZ_signaling	1707..1792	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1811..1834
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900