Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189476.1 | Gene: | SYNJ2BP-COX16 / 100529257 | HGNCID: | 48350 | Length: | 191 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 39/197 - (19%) |
---|---|---|---|
Similarity: | 72/197 - (36%) | Gaps: | 59/197 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 GMEVTGGIDQ-----FEPLTIVNVSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRKN 102
Fly 103 SRYV-------RVYV-------RGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKP 153
Fly 154 VYKESNCFMVPSKMEEKIRARRAATSAVHK--KDELAPHTRSLTPTPRPKNQPGPNLLETVLRPR 216
Fly 217 GP 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 19/86 (22%) |
SYNJ2BP-COX16 | NP_001189476.1 | PDZ_signaling | 13..97 | CDD:238492 | 17/73 (23%) |
DegQ | <16..77 | CDD:223343 | 12/52 (23%) | ||
COX16 | <133..173 | CDD:290843 | 7/40 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |