DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and SYNJ2BP-COX16

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001189476.1 Gene:SYNJ2BP-COX16 / 100529257 HGNCID:48350 Length:191 Species:Homo sapiens


Alignment Length:197 Identity:39/197 - (19%)
Similarity:72/197 - (36%) Gaps:59/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GMEVTGGIDQ-----FEPLTIVNVSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRKN 102
            |..:.||.||     ...:.:..:...|.|...| ::.||:|..:|......:...:|:.:|| |
Human    24 GFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFR-N 87

  Fly   103 SRYV-------RVYV-------RGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKP 153
            :.|.       |:.|       ||:.|..|                    .||....      .|
Human    88 AGYAVSLRVQHRLQVQNGPIGHRGEGDPSG--------------------IPIFMVL------VP 126

  Fly   154 VYKESNCFMVPSKMEEKIRARRAATSAVHK--KDELAPHTRSLTPTPRPKNQPGPNLLETVLRPR 216
            |:..:   |:..::|:|::..:.:..:.::  ||......:::. .|||...|      .:|:.|
Human   127 VFALT---MMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIR-GPRPWEDP------DLLQGR 181

  Fly   217 GP 218
            .|
Human   182 NP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 19/86 (22%)
SYNJ2BP-COX16NP_001189476.1 PDZ_signaling 13..97 CDD:238492 17/73 (23%)
DegQ <16..77 CDD:223343 12/52 (23%)
COX16 <133..173 CDD:290843 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.