DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and grip2

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_031757025.1 Gene:grip2 / 100495373 XenbaseID:XB-GENE-854056 Length:1115 Species:Xenopus tropicalis


Alignment Length:108 Identity:28/108 - (25%)
Similarity:53/108 - (49%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
            |:::.| |.|..|.......:.||:|     :..|....|:.::|..:.|:|:.|..::..|||:
 Frog   677 KLKIRK-DEDNSDEQETSGAIIYTVE-----LKRYGGPLGITISGTEEPFDPIVISGLTKRGLAE 735

  Fly    70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVR 111
            | |.:.:||.|..||:|.......:||:.:.:.....|.:.::
 Frog   736 RTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIK 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 21/81 (26%)
grip2XP_031757025.1 PDZ_signaling 87..169 CDD:238492
PDZ_signaling 187..272 CDD:238492
PDZ_signaling 287..370 CDD:238492
PDZ_signaling 499..585 CDD:238492
PDZ_signaling 598..681 CDD:238492 1/3 (33%)
PDZ_signaling 697..778 CDD:238492 23/85 (27%)
PDZ_signaling 1007..1084 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.