DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and pdzd7a

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001177686.1 Gene:pdzd7a / 100332580 ZFINID:ZDB-GENE-090313-191 Length:954 Species:Danio rerio


Alignment Length:221 Identity:49/221 - (22%)
Similarity:89/221 - (40%) Gaps:48/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIMSFY----DAMWGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNE 94
            ||:..|    |...|..:.||.:....:.:..:.|.|||::.|:::||:|...|.|...::|.:.
Zfish   194 RIVHLYTTSDDYCLGFNIRGGKEFGLGIYVSKLDPGGLAEQNGIKMGDQILAANGVSFEDITHSN 258

  Fly    95 ALQMFRKNSRYVRVYVRGDDDAPGEEDWTCD-CWF-------KPRKPWRRDF----------TPI 141
            |:::. |:..:|.:.::.....|..::...: .|.       :|......|.          ||:
Zfish   259 AVEVL-KSHTHVMLTIKEAGRYPAYKEMVAEYSWLNKLANGGQPSSSQGSDSYSSTSSLSSGTPV 322

  Fly   142 -------QWTFPWNDRRKPVYKESNCFMVPSKMEEKIRARRAATSAVH---KKDELAPHTRSLTP 196
                   |.|||      |.:...   ||...:..:.|:||.::..:.   :.|...|.|.|.|.
Zfish   323 SSLSGLSQVTFP------PAFGSE---MVDVCISTEDRSRRPSSERIETAIQTDPQDPDTISRTS 378

  Fly   197 ---TPRPKNQPGPNLL--ETVLRPRG 217
               :.......|..:|  :||:| ||
Zfish   379 RVMSTETSRMVGETVLLKDTVIR-RG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 21/80 (26%)
pdzd7aNP_001177686.1 PDZ_signaling 69..149 CDD:238492
PDZ_signaling 194..274 CDD:238492 21/80 (26%)
HN_PDZD7_like 568..645 CDD:259824
PDZ_signaling 860..948 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.