DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and ChiC

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:343 Identity:81/343 - (23%)
Similarity:148/343 - (43%) Gaps:61/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YRTVTR-LKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYG 156
            :.|.|: ::|:.|:||.|||:||.   ..||.|      |..:..:||.|..|:::...:.::||
plant    76 FSTFTQTVQRRNPSVKTLLSIGGG---IADKTA------YASMASNPTSRKSFIDSSIRVARSYG 131

  Fly   157 FDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDN 221
            |.|||:.|::|.:..:.  :..|:|.:.::                    :|::.:..::.:|..
plant   132 FHGLDLDWEYPSSATEM--TNFGTLLREWR--------------------SAVVAEASSSGKPRL 174

  Fly   222 LLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVA 286
            ||.:.....|...|:.|.:.||.:.||:|||..:||:.|..: .|....|.:::.|...|..:  
plant   175 LLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWS-RVTGPPAALFDPSNAGPSGD-- 236

  Fly   287 AQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEV 351
            |..:.|::...||.|..:|...||..|:||:.:..:...|.        .|......|...:.::
plant   237 AGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPT--------TGAAISPDGSIGYGQI 293

  Fly   352 CALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTE 416
            ...:  .:|......|:.::         |.|.|     .|.|  |:.::|..:...|..|.:..
plant   294 RKFI--VDNGATTVYNSTVV---------GDYCY-----AGTN--WIGYDDNQSIVTKVRYAKQR 340

  Fly   417 NLGGVALFDLSYDDFRGL 434
            .|.|...:.:..||..||
plant   341 GLLGYFSWHVGADDNSGL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 81/343 (24%)
Glyco_18 31..429 CDD:214753 77/336 (23%)
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 81/343 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.