DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and AT4G19740

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:204 Identity:55/204 - (26%)
Similarity:90/204 - (44%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSL---WKGFKKVFSGDSIVDEKSE 200
            |.|..|:::..|:.::.||.|||:||::|.|..:.  :..|.|   |:         |.|:.:|:
plant     6 TSRESFISSSISIARSLGFYGLDLAWEYPNNDVEM--NNFGKLLQEWR---------SAVEVESQ 59

  Fly   201 EHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVN-SSLFYDIPAVVNYLDFVNLGTFDFF--TPQR 262
                         :...||  |||:..|....: :|:.|.:.|:...||:|||..::|:  |.:.
plant    60 -------------RTGIRP--LLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLTTEI 109

  Fly   263 NPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPV 327
            .|     .|.:|:.|.:.|..:..  :|:||:...|..|...|....|..|.|.||         
plant   110 GP-----PAGLYDPSIKGPCGDTG--LKHWLKAGLPEKKAVFGFPYVGWSWTLDDD--------- 158

  Fly   328 KDVKDEAPV 336
            ||..|:..|
plant   159 KDHGDDVAV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 55/204 (27%)
Glyco_18 31..429 CDD:214753 55/204 (27%)
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 51/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.