DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and AT4G19720

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001319998.1 Gene:AT4G19720 / 827716 AraportID:AT4G19720 Length:363 Species:Arabidopsis thaliana


Alignment Length:350 Identity:76/350 - (21%)
Similarity:129/350 - (36%) Gaps:93/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVA 163
            :|:|.|:|:.|||:||.   ..||.|      :..:..:||.|..|:.:..|..:.|.|||||:.
plant    72 VKKKNPHVQTLLSIGGR---NADKSA------FASMASNPTSRKSFIWSAISSARYYRFDGLDLV 127

  Fly   164 WQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTV 228
            |::||:..:.  ...|.|.:.:::....|:   |::|                 |...||.:...
plant   128 WKYPKDDVEM--RNFGQLLEQWREAIEDDA---ERTE-----------------RMPLLLTAAVY 170

  Fly   229 LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQ------------RNPE--VADYAAPIYELSER 279
            ...|..|:.|.|..:...||:|||..:||::..            .||:  ..||.         
plant   171 YSPVYDSVSYPIREIKKKLDWVNLIAYDFYSSSTTIGPPAALFDPSNPKGPCGDYG--------- 226

  Fly   280 NPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPG 344
                     :|.|::...||.|..:|....|..|.|  .||:          |.|.....|...|
plant   227 ---------LKEWIKAGLPAKKAVLGFPYVGWTWSL--GSGN----------DAATSRVATSAEG 270

  Fly   345 IYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADK 409
            ..::.::..|:.:.....:..:..           .|.|.:....       .:.::|..:...|
plant   271 SINYDQIKRLIVDHKARPVFDSTV-----------VGDYCFAGTS-------LIGYDDHQSVVAK 317

  Fly   410 AGYVRTENLGGVALFDLSYDDFRGL 434
            ..|.:.:.|.|...:.:..||..||
plant   318 VKYAKQKGLLGYFSWHVGADDNFGL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 75/349 (21%)
Glyco_18 31..429 CDD:214753 72/343 (21%)
AT4G19720NP_001319998.1 GH18_plant_chitinase_class_V 3..343 CDD:119358 75/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.