powered by:
Protein Alignment Idgf6 and btb-18
DIOPT Version :9
Sequence 1: | NP_001286499.1 |
Gene: | Idgf6 / 36868 |
FlyBaseID: | FBgn0013763 |
Length: | 452 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_872066.2 |
Gene: | btb-18 / 353391 |
WormBaseID: | WBGene00018201 |
Length: | 298 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 25/60 - (41%) |
Gaps: | 14/60 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LPKKHLVCYYDSASFVKEGLGKLV--IDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQ 83
|.:.|....:| |..|.:.|.| || ::|..|....|..::| ||:|..:
Worm 47 LSQIHFTWKFD---FASEDIEKFVGTID-----VKFRQYQFQNYVTVQR----AVTLTDR 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Idgf6 | NP_001286499.1 |
GH18_IDGF |
30..450 |
CDD:119352 |
15/56 (27%) |
Glyco_18 |
31..429 |
CDD:214753 |
14/55 (25%) |
btb-18 | NP_872066.2 |
BTB |
141..237 |
CDD:197585 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.