DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and Cht10

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:455 Identity:128/455 - (28%)
Similarity:206/455 - (45%) Gaps:91/455 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVGAPQLPKKHL--------------------VCYYDSASFVKEGLGKLVIDELEPALQFCDYLV 64
            |...||.|..||                    :||:.:.::.::|:|:...|::...|  |.:::
  Fly   936 KPPTPQTPSSHLRPTYPTEKPVPKPRDSHYKVICYFTNWAWYRKGIGRFTPDDINTEL--CTHVI 998

  Fly    65 YGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN 129
            ||:|.:  |..:.|........|:....|..||.||.|  .:|:.|::||..|.:.|        
  Fly   999 YGFAVL--DYSELVLRTHDSWADVENNFYTRVTSLKSK--GIKVSLALGGWNDSQGD-------- 1051

  Fly   130 KYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSI 194
            ||..|:.||..|:|||......::.|||:|||:.|::|.....:.:.|                 
  Fly  1052 KYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPVCWQTECNKG----------------- 1099

  Fly   195 VDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPN---VNSSLFYDIPAVVNYLDFVNLGTFD 256
                |.|.|:.|||.::::..||||..|:|||.|.|:   :::.  ||||.:..|.|::.:.|:|
  Fly  1100 ----STEEKDGFTAWVQELSEAFRPRGLMLSTAVSPSRKIIDAG--YDIPQLSRYFDWIAVMTYD 1158

  Fly   257 FFTPQRNPEVADYAAPIYELSERNPE-FNVAAQVKYWLRNNCPASKINVGVATYGRPWKL--TDD 318
            |.  ....:...:.||:|...:.:.| |||...:.||:....|:.|:.:|:..||:.:.|  |:.
  Fly  1159 FH--GHWDKKTGHVAPLYHHPDDDFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQSFTLENTNS 1221

  Fly   319 SGDTGVPPVKDVKDEAP--VGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFG 381
            ||       .:.|..||  .|..|:..|..::.|:|..:..|....          |.|...|.|
  Fly  1222 SG-------LNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQV----------VHDEFGRMG 1269

  Fly   382 SYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAI 446
            .|||:...       |||::.||....|:..||:..|||..::.|..|||:..|.|..:|:|..|
  Fly  1270 PYAYKGTQ-------WVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNRCGNGVHPLLTEI 1327

  Fly   447  446
              Fly  1328  1327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 124/445 (28%)
Glyco_18 31..429 CDD:214753 115/425 (27%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 114/406 (28%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 122/424 (29%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463777
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.