DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and chil-27

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:146 Identity:37/146 - (25%)
Similarity:61/146 - (41%) Gaps:43/146 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RTVTRLKRK----YPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKT 154
            ||.::||.|    ..:.|.|||:||..:.:.      ||    .::..|..:.||..::.|:::.
 Worm   124 RTFSKLKEKSKIESSHFKKLLSIGGRSNTQF------LP----LVIADPRRKRRFFKSIISILEE 178

  Fly   155 YGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRP 219
            |..||:|:.|::.||...|..|                ..:.|..::.||             |.
 Worm   179 YQLDGVDLLWKWAKNSNTKKCS----------------RFLCELKQKLKE-------------RK 214

  Fly   220 DNLLLSTTVLPNVNSS 235
            .|.:||..:||:..||
 Worm   215 KNYVLSVQILPDEPSS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 37/146 (25%)
Glyco_18 31..429 CDD:214753 37/146 (25%)
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 35/142 (25%)
GH18_chitinase-like 97..>235 CDD:299167 37/146 (25%)
Glyco_hydro_18 261..>402 CDD:279094
GH18_chitinase-like 268..>407 CDD:299167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.