DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and K08F9.3

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:269 Identity:48/269 - (17%)
Similarity:94/269 - (34%) Gaps:100/269 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIKALAIVSLCLAS--IQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVID----ELEPALQF 59
            :.:....|.||...|  :|::   .|....|.|:.||:...      |:.:::    .|..|:..
 Worm    95 LFVLIFGIYSLVSHSGHVQST---TPDQCDKQLIGYYNGIE------GRNILENQFHNLTHAVFT 150

  Fly    60 CDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDA 124
            .:::  ...|...:|||     :|..|:..|       :|.......||::::|.:|        
 Worm   151 SEFV--NENGSFENSHK-----EQEFLECRK-------KLGESNSTAKIMIAMGFNK-------- 193

  Fly   125 KELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVF 189
                           |..: ::.:.|.::.|..||:::.|                         
 Worm   194 ---------------GSCK-IDCITSFIEKYQVDGVELHW------------------------- 217

  Fly   190 SGDSIVDEKSEEHKEQFTALL---RDVKNAFRPDNLLLSTTVLPNVNSSLFY----DIPAVVNYL 247
                       .|.|.|.:.|   |::||..:.    :|.:.|..|::|..:    ::..|:...
 Worm   218 -----------NHNEHFLSQLETTRNLKNRLKK----ISNSKLLGVSASSNWSRVTELDQVLEVA 267

  Fly   248 DFVNLGTFD 256
            ||||:...|
 Worm   268 DFVNIELHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 41/238 (17%)
Glyco_18 31..429 CDD:214753 41/237 (17%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 40/233 (17%)
GH18_chitinase-like 124..276 CDD:299167 40/235 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.