DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and T19H5.6

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:262 Identity:54/262 - (20%)
Similarity:108/262 - (41%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIIKALAIVSLCLASIQASKV----GAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCD 61
            ::|..::||:|.|..:..|.|    .||.:.:|.::.||....     ..::.|:|:..    ..
 Worm    36 ILIIFMSIVTLGLVVVIRSFVFVEENAPTVCEKRVIGYYAGTE-----KSQITIEEVSE----LT 91

  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRL-KRKYPNVKILLSVGGDKDIELDKDAK 125
            :.|:.:..:..|.....|...|      :..:..:..| |.:...||::.|:||          |
 Worm    92 HAVFAFVYMATDGTLMFSNQAQ------RNRFLKLKELTKNENSTVKMMFSIGG----------K 140

  Fly   126 ELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFS 190
            :....:..:..||..:..|:|.:..|::.|..||:|:.|::||:                     
 Worm   141 DNSQNFSPVTASPDRKKSFINAILELLEKYDLDGVDLFWRWPKS--------------------- 184

  Fly   191 GDSIVDEKSEEHKEQFTALLRDVKNAF--RPDNLLLSTTVLP-NVN--SSLFYDIPAVVNYLDFV 250
                      :.|:::...||::|...  |..:.:||..|.| ::|  .|.| ||..::.:.||:
 Worm   185 ----------DDKDEYAVFLRELKKQLKARRKDYILSVVVAPLDINRWDSKF-DIKKIIKHADFI 238

  Fly   251 NL 252
            ::
 Worm   239 SI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 44/229 (19%)
Glyco_18 31..429 CDD:214753 44/228 (19%)
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 44/229 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.