DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and si:ch211-226m16.2

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001191302.1 Gene:si:ch211-226m16.2 / 100003708 ZFINID:ZDB-GENE-030131-2302 Length:410 Species:Danio rerio


Alignment Length:256 Identity:60/256 - (23%)
Similarity:95/256 - (37%) Gaps:87/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AIVSLCLASIQASKVGAPQLPKKHLVCYYDSAS-FVKEGLGKLVIDELEPALQFCDYLVYGYAGI 70
            |...|||    ...||| |..:..|.||.|..: ..:||              .|.:::.     
Zfish     6 AFAFLCL----VVSVGA-QRTQSRLSCYLDVLTPHTREG--------------SCTHIIL----- 46

  Fly    71 ERDSHKAVSLNQQLDL-DLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLEL 134
                 .:||.:.:|.| .|.:..|..:.|:|.:...:||||.:             |:.:..|:|
Zfish    47 -----PSVSSDDELYLQSLTENEYDAIQRMKERNSALKILLGL-------------EIKSSRLKL 93

  Fly   135 L---ESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVD 196
            :   |:..|  .|:.|:.:.:|....|||||.|.                               
Zfish    94 MSANEASVG--SFIQTLLTYLKEKRLDGLDVIWL------------------------------- 125

  Fly   197 EKSEEHKEQFTALLRDVKNAF----RPDNLLLSTTVL-PNVNSSLFYDIPAVVNYLDFVNL 252
            :.:....|.||..|:.:|..|    ||  ||||.:|. |...:...||...:..|:||:::
Zfish   126 DGTPSDTELFTDFLKSIKGVFEEEMRP--LLLSASVKEPTDKTVASYDEQILSQYVDFISI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 52/233 (22%)
Glyco_18 31..429 CDD:214753 52/232 (22%)
si:ch211-226m16.2NP_001191302.1 GH18_chitinase-like 41..>185 CDD:324582 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.