DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and YOL162W

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:48/224 - (21%)
Similarity:85/224 - (37%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 LPTYMKQVLR---FSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQY 378
            |.||:..|||   |:.....|| ::|...:.:..:|   ...|          :|.|..|.:   
Yeast    12 LATYLTLVLRSIGFTTFQANLL-AIPNFVLHILLLF---GLTW----------STEKCNNRL--- 59

  Fly   379 GPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDL-TPRFAGFLMS---------- 432
              |::|:...||    ...||:|....|.....:..:.|..|.| .|......:|          
Yeast    60 --GLSLLQPLYT----VPLLAVLRFWKGTMFNKWGTYAIITLILDNPYIHAICVSLCSRNSQSVK 118

  Fly   433 ---ITNCSANL---AGLLAPIAAGHLISDPSKPMMGQWQ-IVFFIAAFVY-IICGT--FYNIFGS 487
               ::.|..|:   |||   |.:.::.:....|:..:.. ::|.:|.|:: |:.|:  .|.....
Yeast   119 TRTVSTCLYNMFVQAGL---IISSNIYAKSDAPLYRKGNGVLFGLALFMFPILIGSKLIYVYINK 180

  Fly   488 GERQYWDNPEDDEQKPALQTTVTTSPARL 516
            ...:.|:...::|:...|.||......||
Yeast   181 QRDKRWNAMSEEEKDHYLSTTSDAGSRRL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 42/207 (20%)
MFS 100..485 CDD:119392 41/191 (21%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.