DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and YCT1

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_013045.1 Gene:YCT1 / 850671 SGDID:S000003978 Length:531 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:50/248 - (20%)
Similarity:95/248 - (38%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPI 179
            |:.|:.|.|.|...||:|....:||| |:|  :.:..|:.::.......|:.|:||..||.|..:
Yeast   103 FYVGFAIGQFPGQYLAQKLPLGKFLG-GLL--ATWTILIFLSCTAYNFSGVVALRFFLGLTESVV 164

  Fly   180 VPCTHAMLAKWIPPNERSR---------MGAAVYAG-AQFGTI-ISMPLSGLLAEYGFDGGWPSI 233
            :|.....:..:...:||:.         ||:.:..| ..:|.: |:.|...|         |...
Yeast   165 IPILITTMGMFFDASERAAAQPFFFAACMGSPIPTGFIAYGVLHITNPSISL---------WKIF 220

  Fly   234 FYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKY--INDSLWGTDVVKSPPIPFKAIIKSLPF 296
            ..:.|.:..:.::..:::...:|:        :.|:  |.:.:|              ||:.:. 
Yeast   221 TIIIGGLTFIMTVVVILWFPNNPA--------DVKFFSIQERVW--------------IIRRVQ- 262

  Fly   297 YAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMF 349
                 |..|.:       .|...:.|...|.::|.        |:. |||.:|
Yeast   263 -----ASTGSS-------IEQKVFKKSQFREAMKD--------YIT-WLFGLF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 50/248 (20%)
MFS 100..485 CDD:119392 50/248 (20%)
YCT1NP_013045.1 MFS_FEN2_like 54..462 CDD:340885 50/248 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.