DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and PHT4;5

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001330368.1 Gene:PHT4;5 / 832160 AraportID:AT5G20380 Length:569 Species:Arabidopsis thaliana


Alignment Length:473 Identity:128/473 - (27%)
Similarity:216/473 - (45%) Gaps:72/473 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PQRCFATRYFVTFMLFLGMANAYVM----RTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPI 93
            |||         :.|....:.|:|:    :.|:|:||:.| :|                      
plant   148 PQR---------YKLIGATSLAFVICNMDKVNLSIAIIPM-SH---------------------- 180

  Fly    94 DDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAAR 158
                  :|.|||::.|.:.||||:||.::|:|.|.|:|.:|..:.|..|:...|....|||:.| 
plant   181 ------QFGWSSSVAGLVQSSFFWGYALSQLPGGWLSKIFGGRKVLEIGVFTWSFATALVPLLA- 238

  Fly   159 GGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAE 223
             |.:.||...|.:.|:|||........::|:.||..||||....|:.|...|:::.:.|:..:.|
plant   239 -GFMPGLIFSRILVGIGEGVSPSAATDLIARTIPVKERSRAVGFVFGGLSLGSVMGLLLAPPIIE 302

  Fly   224 YGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPS--------SHPTIDEREKKYINDSLWGTDVV 280
               ...|.|:||:||::|..|.:.|.....|:.|        ||.: :...|:.:..||      
plant   303 ---TFNWESVFYLFGLLGVGWFVGFQFLNEEEVSYKGNEISTSHKS-ENATKEELGSSL------ 357

  Fly   281 KSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWL 345
              ..||:|:..:|...:|:::.|...::|:.|.::.||||..:.|..:|.....:|.||.||..:
plant   358 --KEIPWKSFFQSPAVWAMIYTHFCGSWGHYTCLSWLPTYFSEALSLNLTEAAWVSILPPLASIV 420

  Fly   346 FSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASY-TGCDRALTLAILTIGVGLNG 409
            .:...|..||::|:: ....|..||:..:|....|.:.:..:|. .|......:.|||.|:.|:.
plant   421 VTSLASQFADYLITN-GVDTTTVRKICQTIAFVAPAICMTLSSVDIGLPPWEIVGILTAGLALSS 484

  Fly   410 GIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFV 474
            ...||....|.|::|.:|..|:.|||....:.|::.....|.|:....     .|.:..|:.:..
plant   485 FALSGLYCTHQDISPEYASILLGITNTVGAVPGIVGVALTGFLLDSTH-----SWTMSLFVPSIF 544

  Fly   475 YIICGT-FYNIFGSGERQ 491
            :.:.|| .:..|.|.|.|
plant   545 FYLTGTVVWLAFASSEPQ 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 125/465 (27%)
MFS 100..485 CDD:119392 112/394 (28%)
PHT4;5NP_001330368.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm8397
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.