DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and PHT4;1

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_180526.1 Gene:PHT4;1 / 817515 AraportID:AT2G29650 Length:512 Species:Arabidopsis thaliana


Alignment Length:456 Identity:154/456 - (33%)
Similarity:235/456 - (51%) Gaps:47/456 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FATRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEF 101
            |..|:.:..:.|.......:.|.|||:||:.|                             ..|:
plant    99 FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM-----------------------------SAEY 134

  Fly   102 AWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLC 166
            .|:.|..|.|.||||:||::|||..||.|...|..|.||:|::..|:...|.||||:.|..: |.
plant   135 GWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPY-LL 198

  Fly   167 AVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWP 231
            .||...|:|||..:|..:.:|:||:|..||||..|.||:|...|::..:..|..|..   ..|||
plant   199 VVRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIH---QFGWP 260

  Fly   232 SIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSPPIPFKAIIKSLPF 296
            |:||.||.:||||...:|......|...||:...|:|.|.|:....:.|||  ||::.|:...|.
plant   261 SVFYSFGSLGTVWLTLWLTKAESSPLEDPTLLPEERKLIADNCASKEPVKS--IPWRLILSKPPV 323

  Fly   297 YAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSK 361
            :|::..|..||:|...|:|.:|||..|||:|:|..:||||..|::.|.:.:.....:||.:: |:
plant   324 WALISCHFCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLV-SR 387

  Fly   362 RFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGV--GLNGGIYSGFKINHLDLTP 424
            .||.|..||::.:||..||...|....:..   :.|:|:|.:..  |.:....||...||.|:.|
plant   388 GFSVTNVRKIMQTIGFLGPAFFLTQLKHID---SPTMAVLCMACSQGTDAFSQSGLYSNHQDIAP 449

  Fly   425 RFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGE 489
            |::|.|:.::|.:..|||:|...|.||::..      |.|..||.|:..:|::....:|:|.:||
plant   450 RYSGVLLGLSNTAGVLAGVLGTAATGHILQH------GSWDDVFTISVGLYLVGTVIWNLFSTGE 508

  Fly   490 R 490
            :
plant   509 K 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 152/452 (34%)
MFS 100..485 CDD:119392 141/386 (37%)
PHT4;1NP_180526.1 MFS_SLC17A9_like 106..505 CDD:340938 149/443 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm8397
orthoMCL 1 0.900 - - OOG6_100421
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.