DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and slc37a4b

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001315024.1 Gene:slc37a4b / 393914 ZFINID:ZDB-GENE-040426-827 Length:453 Species:Danio rerio


Alignment Length:507 Identity:96/507 - (18%)
Similarity:164/507 - (32%) Gaps:163/507 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FATRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEF 101
            :.|..|::  :|:|....|..|...|..:.:::                   .:|.:|..:    
Zfish     9 YRTVIFIS--MFVGYMLYYFNRKTFSFLMPSVM-------------------EEIELDKEE---- 48

  Fly   102 AWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLI-----------NSVFAFLVPV 155
                  .|.|.||....|.|::...|:|:.:..:......|:.|           ::|..|.|  
Zfish    49 ------LGLITSSQTLAYAISKFISGVLSDRISARWLFSIGLFIVGTINIAFSCSSTVMLFTV-- 105

  Fly   156 AARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGT-----IISM 215
                  :|      |:.|.|:|...|....:|.||..|             :||||     ..||
Zfish   106 ------LW------FVNGFGQGFGWPPCGKVLRKWFEP-------------SQFGTWWAILCCSM 145

  Fly   216 PLSG--------LLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPS--SHPTIDEREKK-- 268
            .|:|        :|.:| :|  |..|..|.|::....::..|:.|..:||  ..|:|....||  
Zfish   146 NLAGSLGPIITTVLVQY-YD--WRVIMSVSGLICMAVAVVCLLMVKNEPSDVGLPSIQPGAKKGK 207

  Fly   269 ----YINDSLWGTDVVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSL 329
                ..||.....|.:.|            |:..:|.|.....:|.:...|:    ..|:.....
Zfish   208 GKKGGPNDESSLKDFLLS------------PYLWVLSAGYLVVFGVKIACTD----WGQLFLMQE 256

  Fly   330 KSNGLLSSLPYL-AMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYG-PGVALIAASYTG- 391
            |....:....|: |:.:...|.|:.|.::      |..|..:  ..:|.|| |...|:.....| 
Zfish   257 KGQSAMMGSSYMSALEVGGFFGSIGAGYL------SDRAVAR--QGLGVYGNPRHGLLLMMMAGM 313

  Fly   392 -----------------------------------CDRALTLAILTIGVGLNG-GIYSGFKINHL 420
                                               .::.|.:.||....|.:. |..:.|.:...
Zfish   314 AVSMYLFRVTITPETPEEAPLWVLALHPVSVLTGVSEKELWILILGAAFGFSSYGPIALFGVIAS 378

  Fly   421 DLTP-RFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIA 471
            :..| .|.|...:|....||:...:|.:....:....|      |...|::|
Zfish   379 ESAPSNFCGTSHAIVALMANVGAFIAGLPFSTIAKRYS------WDTAFWVA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 95/503 (19%)
MFS 100..485 CDD:119392 87/444 (20%)
slc37a4bNP_001315024.1 UhpC 18..421 CDD:332119 92/491 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.