DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and Slc17a9

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:381 Identity:89/381 - (23%)
Similarity:154/381 - (40%) Gaps:90/381 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQRCFATRYFV-------TFMLFLGMANAYVMR 58
            ||.:||||             .:.:.|...:.|......:.:.       |.||.||....|..|
  Rat     1 MPSQRSSL-------------MQPIPEETRKTPSAAAEDKRWSRPECQLWTGMLLLGTCLLYCTR 52

  Fly    59 TNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQ 123
            ..|.|..|||                           |||  |.|:....|.:|||||:||.:||
  Rat    53 VTMPVCTVAM---------------------------SQD--FGWNKKEAGIVLSSFFWGYCLTQ 88

  Fly   124 IPFGILAKKYGSLRFLGYGMLINSVFAFL---VPVAAR-GGGVWGLCAV-RFIQGLGEGPIVPCT 183
            :..|.|..:.|..:.:   :|..|.:.|:   .|:.|. |.|....... |.:.||.:|...|..
  Rat    89 VVGGHLGDRIGGEKVI---LLSASAWGFITVTTPLLAHLGSGHLAFVTFSRILTGLLQGVYFPAL 150

  Fly   184 HAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAF 248
            .::|::.:..:|||...:.|.||:|.||:::..:..:|.:   ..||.|:||..|.:..:|    
  Rat   151 TSLLSQRVQESERSFTYSTVGAGSQVGTLVTGGIGSVLLD---RCGWQSVFYFSGGLTLLW---- 208

  Fly   249 LIFVHEDPSSHPTIDEREKKYINDS----------LWGTDVVKSPPIPFKAIIKSLPFYAILFAH 303
            :.:|:              ||:.|.          ..|..|.:...:|::.:.:....:|::.:.
  Rat   209 VYYVY--------------KYLLDEKDLVLALGVLAQGLPVTRPSKVPWRQLFRKASVWAVICSQ 259

  Fly   304 MGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMIS 359
            :.....:..|::.|||:.|:.  |......:.:.:|:|.....|:|...::|.:||
  Rat   260 LSSACSFFILLSWLPTFFKET--FPHSKGWVFNVVPWLLAIPASLFSGFISDRLIS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 81/341 (24%)
MFS 100..485 CDD:119392 66/275 (24%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 81/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.