DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and Slc17a4

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_795990.2 Gene:Slc17a4 / 319848 MGIID:2442850 Length:492 Species:Mus musculus


Alignment Length:469 Identity:156/469 - (33%)
Similarity:250/469 - (53%) Gaps:12/469 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EQQPQRCFAT-RYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSG-EAEEYDDECGDRDI- 91
            ||..::.|.: |:.:.|:|.|...:.|..:.|:|.||.||||.|...|. .|.........:|: 
Mouse    22 EQSFKKGFCSLRHGLAFILHLCNFSIYTQQMNLSFAITAMVNTTVASSQLNASTERPPTNSQDVW 86

  Fly    92 --PIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVP 154
              .:.:|:...:.|:..:||.:|||..||..|..||.|.:|..:|:...:|.|:||:||....:|
Mouse    87 NETLQESKAPVYDWTPEIQGILLSSLSYGSFIAPIPTGYVAGVFGAKYVVGLGLLISSVLTLFIP 151

  Fly   155 VAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSG 219
            :|| ..||..|..:|.|||:.:..::...:::.|||.||.|||::.....:|:..||.:.:...|
Mouse   152 LAA-DAGVALLIVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQLITIAASGSMLGTFLVLIAGG 215

  Fly   220 LLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSPP 284
            |:.:   ..|||.|||:||.:|....:.:...|::||.:||.|...|::||..||...|......
Mouse   216 LICQ---ALGWPYIFYIFGGIGCACCLLWFPLVYDDPQNHPFISTGERRYITCSLAQEDCSLGWS 277

  Fly   285 IPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMF 349
            :|.||::||||.:||:.::....:...|:|...|||:..||:.:|:.:|:||:||::...:..:.
Mouse   278 LPIKAMVKSLPLWAIVVSYFCEYWLLSTVMAYTPTYISSVLQANLRDSGILSALPFMFGCVCIIL 342

  Fly   350 ISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSG 414
            ..::||:::|.|.......|||..::|.......|:...:....|:.|:|.|.:.........||
Mouse   343 GGLLADFLLSRKILRLVTIRKLFTAVGVLASSGILLPLPWVRSSRSTTMAFLVLSSVFASLCDSG 407

  Fly   415 FKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICG 479
            ..||.||:.||:||||..:....:.|||.:||..||..||..|:  .| |:.|||:||.:.::..
Mouse   408 ALINFLDIAPRYAGFLKGLLQVFSYLAGGIAPTVAGFFISQDSE--FG-WRNVFFLAAAIDVVGL 469

  Fly   480 TFYNIFGSGERQYW 493
            .||.||...|.|.|
Mouse   470 LFYLIFSRAEVQDW 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 152/457 (33%)
MFS 100..485 CDD:119392 130/384 (34%)
Slc17a4NP_795990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
2A0114euk 27..486 CDD:129972 154/464 (33%)
MFS 98..475 CDD:119392 130/383 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838726
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5542
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.690

Return to query results.
Submit another query.