DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and Slc37a3

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001101324.2 Gene:Slc37a3 / 312255 RGDID:1310346 Length:494 Species:Rattus norvegicus


Alignment Length:460 Identity:83/460 - (18%)
Similarity:148/460 - (32%) Gaps:138/460 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DIPIDDSQDGEFAWSS-----------ALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGM 143
            |:|.:       .|||           ...|.:.:.|.:.|.:.....||:..:......|.:||
  Rat    62 DLPAE-------IWSSNHLFPSTEDATLFLGTLDTVFLFSYAVGLFISGIIGDRLNLRWVLSFGM 119

  Fly   144 LINSVFAFLVPVAARG---GGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYA 205
            ..::...|:.......   ...|..|.:..:.||.:....||..|::..|.     .:.|..|..
  Rat   120 CSSAFVVFVFGTLTEWLHFYNKWFYCGLWIVNGLLQSTGWPCVVAVMGNWF-----GKAGRGVVF 179

  Fly   206 G-----AQFGTIISMPLSGLLAEYGFDGGW---PSIFYVFGIVGTVWSIAFLIFV---------- 252
            |     |..|.|:...|:..:.:||::..:   .|:.:..|||     |.|.:.|          
  Rat   180 GLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIV-----IFFGLLVSPEEIGLPSI 239

  Fly   253 -----HEDPSSHPTI------DEREKKYINDSLWGTDVVKS----------PPIPFK---AIIKS 293
                 .|:.|..|.|      |:.|..|..........||:          ..||:.   |.:|.
  Rat   240 EAEAGSEEDSQRPLINGAENEDDYEPNYSIQEDRAVIQVKAISFHQACCLPGVIPYSLAYACLKL 304

  Fly   294 --------LPFYAILFAHMGHNYGYETLMTE---------------LPTYMKQVLRFSLKSNGLL 335
                    ||||      :.:|:|::....:               |..::..||:         
  Rat   305 VNYSFFFWLPFY------LSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQ--------- 354

  Fly   336 SSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAI 400
            ...|.||:.||....|:|.        :|.:...|.:|::      :..|...:.|....:..:.
  Rat   355 KRAPVLALSLFLAVGSLVG--------YSRSPNNKSVNAL------LMTITGFFIGGPSNMVSSA 405

  Fly   401 LTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQ 465
            ::..:|            ..:|....:..|.::|.. .:..|.:......:|:|.....:...|.
  Rat   406 ISADLG------------RQELIQGSSEALATVTGI-VDGTGSIGAAVGQYLVSLIQDNLGWMWV 457

  Fly   466 IVFFI 470
            ..|||
  Rat   458 FYFFI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 83/460 (18%)
MFS 100..485 CDD:119392 81/450 (18%)
Slc37a3NP_001101324.2 MFS_SLC37A3 20..476 CDD:340900 83/460 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.