DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and Slc17a2

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038951630.1 Gene:Slc17a2 / 306950 RGDID:1308821 Length:487 Species:Rattus norvegicus


Alignment Length:475 Identity:153/475 - (32%)
Similarity:242/475 - (50%) Gaps:43/475 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGE---- 100
            ||.:..::..........|.::|:||:||||.|        ::.|       |.:.|.:|.    
  Rat    26 RYALALVMHFSNFTMITQRVSLSIAIIAMVNST--------QHQD-------PANASAEGPVMNL 75

  Fly   101 -----------------FAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSV 148
                             :.||:..||.|.||..||.::|.||.|.||..:|:.:.||.|:||:|:
  Rat    76 LSNRSRGIKDFSTRAAVYQWSTETQGIIFSSISYGIILTLIPSGYLAGIFGAKQILGAGLLISSL 140

  Fly   149 FAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTII 213
            .....|:|| ..||..:..:|.:||:.:|........:.|||.||.|||::.:...:||.||:.|
  Rat   141 LTLFTPLAA-DFGVILVIVIRTVQGMAQGMSWTGQFTIWAKWAPPLERSKLTSIAGSGAAFGSFI 204

  Fly   214 SMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTD 278
            .:.:.||:::   ..|||.|||:||.:|.|..:.:...:::||..||.|..:||:||..|:....
  Rat   205 ILCVGGLISQ---ALGWPFIFYIFGSIGCVCCVLWFTMIYDDPMHHPCISVKEKEYITSSVAQQS 266

  Fly   279 VVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAM 343
            ......||.||:::.||.:||......|.:....::|.||||:..||..:::.:|:|||||::|.
  Rat   267 SSPRRSIPIKAMVRCLPLWAIFMGFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAA 331

  Fly   344 WLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLN 408
            ...::....:||:::|....|....|||.:|:|...|.:..:|..:.......|:.:|.:..|.:
  Rat   332 SSCTILGGQMADFLLSRNLLSLITVRKLFSSLGLLLPSLCAVALPFVTSSYIATIVLLILIPGTS 396

  Fly   409 GGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAF 473
            ....|||.||.||:.||:|.|||.|:......||:::....|.|||..|:   ..|:.|||::|.
  Rat   397 NLCDSGFIINTLDVAPRYASFLMGISRGFGLTAGIISSTTTGFLISQDSE---SGWRNVFFLSAA 458

  Fly   474 VYIICGTFYNIFGSGERQYW 493
            |.:....||.|||..|.|.|
  Rat   459 VNMFGLIFYLIFGQAEIQNW 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 152/474 (32%)
MFS 100..485 CDD:119392 132/405 (33%)
Slc17a2XP_038951630.1 MFS_SLC17 30..471 CDD:340876 146/462 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.