DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and Slc17a8

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_714947.1 Gene:Slc17a8 / 266767 RGDID:628870 Length:588 Species:Rattus norvegicus


Alignment Length:499 Identity:167/499 - (33%)
Similarity:268/499 - (53%) Gaps:39/499 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFAWS 104
            ||.:..|..||...::.:|.|:.||||.|||::.:       |.|  |..:|     |..:|.|.
  Rat    75 RYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTV-------YVD--GKPEI-----QTAQFNWD 125

  Fly   105 SALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVR 169
            ....|.|..|||:||::||||.|.::.|:.:.|..|..:.:.|.....:|.|||......:| ||
  Rat   126 PETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMC-VR 189

  Fly   170 FIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIF 234
            .:|||.||...|..|.|.:||.||.||||:....:.|:..|.:::|||:|:|.:|   .||.|:|
  Rat   190 ILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQY---IGWASVF 251

  Fly   235 YVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLW-GTDVVKSPPI--PFKAIIKSLPF 296
            |::|:.|.:|.:.:|:..:|.|:.||||...|:.||..|:. |.::......  |::....|||.
  Rat   252 YIYGMFGIIWYMFWLLQAYECPAVHPTISNEERTYIETSIGEGANLASLSKFNTPWRRFFTSLPV 316

  Fly   297 YAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSK 361
            |||:.|:...::.:..|:...|.|.::|..|::...||||::|::.|.:.......:||::.|.|
  Rat   317 YAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRK 381

  Fly   362 RFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRF 426
            ..:.||.||::| .|.:|....|:........:.:.::.|.:.||.:|...|||.:||||:.||:
  Rat   382 ILTTTAVRKIMN-CGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRY 445

  Fly   427 AGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQ 491
            |..||.|:|....|:|::.|:..|.:....::.   :||.||.|||.|:.....||.:|.|||:|
  Rat   446 ASILMGISNGVGTLSGMVCPLIVGAMTKHKTRE---EWQNVFLIAALVHYSGVIFYGVFASGEKQ 507

  Fly   492 YWDNPED---------DEQKPALQTTVT----TSP-ARLSNGST 521
            .|.:||:         |:.:.|.:|.:.    .|| .::|.|:|
  Rat   508 DWADPENLSEEKCGIIDQDELAEETELNHEAFVSPRKKMSYGAT 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 159/471 (34%)
MFS 100..485 CDD:119392 132/387 (34%)
Slc17a8NP_714947.1 MFS_SLC17A6_7_8_VGluT 79..502 CDD:340940 149/444 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 539..588 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.