DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and SLC37A4

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:512 Identity:109/512 - (21%)
Similarity:167/512 - (32%) Gaps:193/512 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFVTFM---LFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFA 102
            |:.|.:   :|.|.:..|..|...|..:.::|                   .:||:|...     
Human     8 YYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLV-------------------EEIPLDKDD----- 48

  Fly   103 WSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGM----LINSVFAF--LVPVAARGGG 161
                 .|:|.||....|.|::...|:|:.:..:......|:    |:|..||:  .|||.|   .
Human    49 -----LGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFA---A 105

  Fly   162 VWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGT-----IISMPLSG-- 219
            :|      |:.||.:|...|....:|.||..|             :||||     ..||.|:|  
Human   106 LW------FLNGLAQGLGWPPCGKVLRKWFEP-------------SQFGTWWAILSTSMNLAGGL 151

  Fly   220 ------LLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTD 278
                  :||:   ...|.|...:.|.:..|.|...|:.:|.:|:                    |
Human   152 GPILATILAQ---SYSWRSTLALSGALCVVVSFLCLLLIHNEPA--------------------D 193

  Fly   279 VVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSL---PY 340
            |                             |...| ..:|:..|   :.|||....|..|   ||
Human   194 V-----------------------------GLRNL-DPMPSEGK---KGSLKEESTLQELLLSPY 225

  Fly   341 LAMWLFSMFISVV-------ADW----MISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDR 394
            |  |:.|....||       .||    :|..|..|.......:::: :.|..|..|||.|.. ||
Human   226 L--WVLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVGSSYMSAL-EVGGLVGSIAAGYLS-DR 286

  Fly   395 ALTLA------------ILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGL---- 443
            |:..|            :|.:..|:...:|. |::.....:|:...|.....:..|.|.|.    
Human   287 AMAKAGLSNYGNPRHGLLLFMMAGMTVSMYL-FRVTVTSDSPKDVAFWTLALHPLAELTGFTEHE 350

  Fly   444 --------------LAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFG 486
                          ..|||...:|::.|.|..               :|||.:.|.|
Human   351 LWILVLGAVFGFSSYGPIALFGVIANESAPPN---------------LCGTSHAIVG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 109/512 (21%)
MFS 100..485 CDD:119392 96/447 (21%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 107/506 (21%)
2A0104 18..419 CDD:273319 107/502 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.