DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and mtre-1

DIOPT Version :10

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_495688.1 Gene:mtre-1 / 174292 WormBaseID:WBGene00011508 Length:158 Species:Caenorhabditis elegans


Alignment Length:74 Identity:17/74 - (22%)
Similarity:25/74 - (33%) Gaps:25/74 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVLIPTLPDVELSI--------RCLKHHHERH-------W------GPFLEERVNVTS----GAA 49
            |:.:..:|...:|.        |||....:.|       |      |.:.||...:.|    |..
 Worm     8 AMSLAQIPSARISSGAASIGQRRCLAGAADHHGSTKVDFWKQPTNPGNWKEEHFVLISLSGWGLL 72

  Fly    50 LQVGYHLST 58
            ...||.|:|
 Worm    73 FYSGYKLAT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 6/22 (27%)
mtre-1NP_495688.1 None

Return to query results.
Submit another query.