DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Picot and Slc17a3

DIOPT Version :9

Sequence 1:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_598830.2 Gene:Slc17a3 / 105355 MGIID:2389216 Length:498 Species:Mus musculus


Alignment Length:481 Identity:159/481 - (33%)
Similarity:241/481 - (50%) Gaps:43/481 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PQRCFATRYFVTFMLFLGMANAYVMRTN--MSVAIVAMVNHT--------------AIKSGEAEE 81
            |..| :.||.:.|:..  ..|..:|..|  :|:.:|||||:|              |..||:..|
Mouse    32 PSLC-SMRYGIAFVTH--FCNFTLMAQNSIISITMVAMVNNTDHPPHLNSSTEQLPAGLSGDQHE 93

  Fly    82 YDDECGDRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLIN 146
                 ..:.:||   :...:.||...||.|.||..||.::.|.|.|.||.|.|:.:.:|..:|.:
Mouse    94 -----ASKHLPI---KAPVYNWSPQTQGIIFSSVQYGMILMQGPGGYLAGKIGTKKVVGIALLGS 150

  Fly   147 SVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGT 211
            |:....:|:||..|.|:.| |.|.:|||.:|.......|:..||.|||||||:.....:|...|.
Mouse   151 SLLTLCIPLAANLGLVFFL-ATRAVQGLMQGTGYGGQFALWQKWAPPNERSRLCTIALSGMTLGI 214

  Fly   212 IISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWG 276
            ...:.:.|:::|   ..|||.:||.||..|.:.|:.:.|.:::||.|||.|...|::||..||..
Mouse   215 FTVLLVGGIISE---ALGWPFVFYSFGGGGVLCSLLWFILIYDDPVSHPWISGPEREYILSSLNQ 276

  Fly   277 TDVVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYL 341
            ....:..|:|.||::||||.:::....|.|.:...|.:...|||:..|.:.:::.||.|||||::
Mouse   277 QFSSEEQPLPIKAMLKSLPLWSMCLCTMTHQWLVNTFIMYTPTYISSVFKVNIRDNGFLSSLPFI 341

  Fly   342 AMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVG 406
            ..|:..:....:||::: ||.|.....||.|..:|...|...:.|..|.......|:..|||..|
Mouse   342 VAWVLGILGGWLADFLL-SKNFRLITVRKFITLLGNAPPAALVAALPYIQSSYITTIIFLTISCG 405

  Fly   407 L----NGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIV 467
            |    ..|||    ||.||:.||:|.|||..:...|:.:.:|.||.||..:|..|:  .| |:..
Mouse   406 LCPLSQAGIY----INALDIAPRYASFLMGTSRGLAHSSAVLVPIVAGFFLSQDSE--FG-WRNF 463

  Fly   468 FFIAAFVYIICGTFYNIFGSGERQYW 493
            ||:...|.::....|.:||..:.|.|
Mouse   464 FFVVFAVNLLGLIIYLVFGKADVQEW 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 156/473 (33%)
MFS 100..485 CDD:119392 134/388 (35%)
Slc17a3NP_598830.2 MFS_SLC17 42..482 CDD:340876 151/461 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.