DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and ppk29

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster


Alignment Length:487 Identity:103/487 - (21%)
Similarity:173/487 - (35%) Gaps:126/487 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LVWLL---ISVVMFICAVVMARTFYMDYRSSPTRMNVESDNTP--VNRLY------FPPVTICPD 106
            |:|:.   ||....:..:|:.:|.|            |:|:|.  |:..|      ||.:.||  
  Fly    22 LLWIFVIGISGWSTVSILVLLKTRY------------ETDSTTIGVSTAYSRWINTFPSIGIC-- 72

  Fly   107 VLFNMQKSEAFLNTLRLPKGAELRGILRKLHIFYGFMLDDERYSAEDIEQMEALLFLNNLTIPEF 171
                :.||.||         .|.:.::|:      :..:|..:|...:....|.|..||:...|.
  Fly    73 ----LTKSRAF---------NEFKAMMRE------YFQEDFAFSFTRMIYEYAFLNPNNIFTKEP 118

  Fly   172 VEHLRW----------------NCDEILYRCRFNGEIM-DCSKIFQLSKTFFGHCCSFNLRQKGW 219
            .::..:                ||.|......|.||:: ||.:||:...|..|:|         :
  Fly   119 TKNTSYPYNFNILDIRRKMFPTNCTECFKEIYFRGELVTDCEEIFKFHVTEMGYC---------F 174

  Fly   220 VNNKLNNLESFKVFHLNSLNFTAQRAIGGLRYGLSVVVRYKDDNYDPLQSYSYGVKLLIQEADAF 284
            :.|.|.:.:|.:...|...:....|:   ||..:...|.||.:.|             :...:..
  Fly   175 LANNLLDYDSIEEMPLRYSSLDNNRS---LRLYMRSSVMYKYEMY-------------VNSPEDL 223

  Fly   285 PSAHSAAKFIAFNSETFAAVRPQETFCSSAVKALIIEERNCVFQNEFPMRYFSDYVYPNCELNCR 349
            |..:|....|:.:..|: |...:|......|....|.:|.|.|.:|..:..| .|.:..|....|
  Fly   224 PFFNSLTYTISTDPTTY-AFNVEEIHNHEGVIDEPISQRKCKFPSESSIEGF-PYSFSACMSIIR 286

  Fly   350 VTNMVKFCGCHTYFFDFNRTSDRICTFRDIPCLVDNFGRLLLICSKYSDFNRLLSANIITRKK-- 412
            ....:|.|.| :.|...:|.....|..:...||:                    .....||.|  
  Fly   287 SEFEMKTCDC-SLFNPKDRNESLYCGLQHADCLI--------------------KEGFATRVKEY 330

  Fly   413 -STQCYCPLTCEHIDYDVQLTNFPLELNMPVADKFYSGLAKNDG--VLHVFINSFSYRRLRRDLL 474
             .:...|..:|  ::..:.|.....|          :|...|:.  :..:.|.|....|..|.:.
  Fly   331 VGSSTVCLPSC--VEQQISLVGVITE----------NGTLYNNNTQITEIQIASPPTVRYERKVT 383

  Fly   475 SNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYF 506
            ...:.|:..:||...||.|.|:|:::|||.||
  Fly   384 QTKLDLIVGIGSVAGLFFGASLLNLLEIISYF 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
ppk29NP_001097442.2 ASC 123..415 CDD:279230 72/351 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.