DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and ppk6

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster


Alignment Length:521 Identity:123/521 - (23%)
Similarity:223/521 - (42%) Gaps:73/521 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TWSDFCATSSIHGLKYTRDEDTNKIVHLVWLLISVVMFICAVVMARTFYMDYRSSPTRMNVESDN 90
            |:.::...:.:.|:...|...|..:...:|..:.:.:.:.::.:....::.:.|.|. :|..|::
  Fly    37 TFWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLLWLKFYSYPI-LNTISND 100

  Fly    91 TPVNRLYFPPVTICPDVLFNMQKSEAFLNTLRLPKGAELRGILRKLHIFYGFMLDDERYSA---E 152
            ..:..:.||.||||...:.|.::.:.::.||::||..::..::........|  .|:.:..   :
  Fly   101 LSITDVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAEVIAGFDFLNAF--TDQSFEPPGHD 163

  Fly   153 DIEQMEALLFLNNLTIPEFVEHLRWNCDEILYRCRFNGEIMDCSK-----IFQLSKTFFGHCCSF 212
            .....:|:|.|||::|.|....:...|.:.:.||.:......|::     .|..:..:.|.||||
  Fly   164 SYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRCFWGHTEFQCNQSHEYLSFIPTTAYLGPCCSF 228

  Fly   213 NLRQKGWVNNKLNNLESFKVFHLNSLNFTAQRAIGGLRYGLSVVVRYKDDNYDPLQSYSYGVKLL 277
            |...:.         .||..|..|         |.|:..||:.|.....:     ::.:.|:.:|
  Fly   229 NYNPRN---------ASFVPFSAN---------IFGMDGGLTFVGAEGSE-----RNLNTGLIVL 270

  Fly   278 IQEADAFPSAHSAAKFIAFNSETFAAVRPQETFCSSAVKALIIEE--RNCVFQNEFPMRYFSDYV 340
            :.....:.:..:|:..|...||:|..|.|  |..||:|:.|.:.|  |:|:...:..:   |:|.
  Fly   271 VHHPMDYVTEAAASVTITAQSESFVEVSP--TVQSSSVEVLELSERKRDCLISGDLQL---SNYR 330

  Fly   341 YPNCELNCRVTNMVKFCGCHTYFFDFNRTSDRICTFRDIPCLVDNFGRLLLICSKYSDFNRLLSA 405
            ...|.|.|:...:||.||||.|.........:.|...|..|...|          |.:|      
  Fly   331 QAACLLACQTEAIVKKCGCHPYLLPIVGNKFKECNLNDTFCYSAN----------YDNF------ 379

  Fly   406 NIITRKKSTQC-YCPLTCEHIDYDVQLTNFPLELNMPVADKFYS-GLAKNDG-VLHVFINSFSYR 467
                  ||.:| .|...|..:.|........|..:.....:||| .|..||. ||.|::......
  Fly   380 ------KSVRCDQCLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNNDSFVLRVYLAKQVVP 438

  Fly   468 RLRRDLLSNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYFSVILRKNYKLECETRSQMLHKKPKFA 532
            .:|:..:.:.:.|:|:||..|:|.:|:||:||||..||.:..|..||:|:       ..::|:.|
  Fly   439 VIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYCTYRLYINYQLQ-------KVQQPRKA 496

  Fly   533 W 533
            |
  Fly   497 W 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
ppk6NP_611461.3 ASC 85..476 CDD:279230 109/443 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112386at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.